SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313206452|ref|YP_004045629.1| from Riemerella anatipestifer ATCC 11845 = DSM 15868

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313206452|ref|YP_004045629.1|
Domain Number 1 Region: 18-224
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-53
Family PP-loop ATPase 0.00022
Further Details:      
 
Domain Number 2 Region: 322-417
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000942
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313206452|ref|YP_004045629.1|
Sequence length 424
Comment tRNA(ile)-lysidine synthetase [Riemerella anatipestifer ATCC 11845 = DSM 15868]
Sequence
MDLFKTKLKELLPNYNEHQFLLAVSGGADSMVLAHLMKQIDAKIEIAHINYKLRSEDSDK
DAALVQEFCEKHHILFHCYTVSEKDQKPSGSIQLWARELRYQFFRNIMKNRSLSHLVTAH
HLNDQLETFIINLSRGSGIKGLAGIPNNENEILRPLLDFSKEEIYHFAEAHSIAFREDKS
NQKQDYLRNKIRHSVVPNLEEINPDFLDNFRKSIDFLSEAKYFINQQIEYKIKEFSISTE
CKTIIDRHALEKESSFIQFEILNRFGFSNKAEISKMFTAETGKSFYSNGYQCLINREQFI
ISKKEPISNNDEDITLPSEKEIKLDQWITYEKKEILEWNFDAEQISLPLKLRRKEAGDFF
YPKGMMGRKKVSKFFKDEKLSILAKSKIWLLCDNENRVLGIVPLRQDGRFASNDKTEKNI
KIIL
Download sequence
Identical sequences gi|313206452|ref|YP_004045629.1| gi|313206452|ref|YP_004045629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]