SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339322036|ref|YP_004680930.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339322036|ref|YP_004680930.1|
Domain Number 1 Region: 629-805
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1-161,191-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.28e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.004
Further Details:      
 
Domain Number 3 Region: 498-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339322036|ref|YP_004680930.1|
Sequence length 853
Comment nitrite reductase [NAD(P)H] large subunit [Cupriavidus necator N-1]
Sequence
MKLIIVGHGMVGHKFLECLAEAGAQNVEVTVLCEEPRPAYDRVHLSEFFAGKSAEDLSLV
PAGFFEQHNNMLLRLNARAVEIDRAARTVKVSTGETLSYDKLILATGSYPFVPPVPGKDR
KDCFVYRTIEDLEAMRECGARSKTGVVVGGGLLGLECAKALRDMDLQTHVVEFAPRLMAV
QVDEGGGRMLRQKIHGLGVTAHTGKNTVEIIDGEDGTHRMVFADGTHLDTDMIVFSAGIR
PRDELARTSGLAVGERGGIVVDNQCLTSDPDIYAIGECALWQGKIYGLVAPGYDMARVAA
RHLQGEAAEFAGADMSTKLKLMGVDVASIGDPHGTVPGARFYQFCDDRKEVYKKLVVSDC
GKYLLGGVLIGDASEYGTLLQMMLNKIELPESPEFLILPDSSGKAKPALGADALPDTAQI
CSCNNVSKSEICAAVCDGATSIGALKTCTKAGTACGGCVPLVTQIMKAEMKKQGMAVNNH
LCEHFPYSRQELYHLVRVGKFKTFDALLEAHGKGMGCDICKPAVGSILASCWNEFVLKEE
HASLQDSNDYYLANIQKDGTYSVVPRMPGGEVTPEGLIAVGQVAKKYGLYTKITGGQRVD
LFGARAEELPFIWEELIAAGFESGHAYGKALRTVKSCVGSTWCRYGVGDSVGLAIELENR
YKGLRAPHKIKFGVSGCTRECAEAQGKDVGVIATDKGWNLYVCGNGGMKPRHAELLASDL
DHDTLVRYIDRFLMFYVRTADRLQRTSVWRDNLEGGLDYLKAVVLDDKLGLAAELEAEMQ
HVVDTYEDEWKKAVTDPETRKRFRHFVNSDRRDDNVAFIEERGQIRPATPEERKLHRSRL
SHIPVVSMPAKAA
Download sequence
Identical sequences F8GRW8
WP_013952409.1.32076 gi|339322036|ref|YP_004680930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]