SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339323992|ref|YP_004682885.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339323992|ref|YP_004682885.1|
Domain Number 1 Region: 85-373
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 7.06e-61
Family Acetamidase/Formamidase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339323992|ref|YP_004682885.1|
Sequence length 411
Comment hypothetical protein CNE_BB2p02300 [Cupriavidus necator N-1]
Sequence
MTAGKIIIDQANDFDAADGSARDEIRRFAGDGGTDRSRRGLLKLAGIGGASMILGGRAHA
ASGIEGERDGARVFDPNRHGKVHTLPSTPETVRVGEMDPAVQSVLEIESGDVVHYQNTWV
HWGNEAKFGMSFAERNVIRKRYPQGPQSLVGPVSIKGAVPGDVIECRMIRLRPIDWGWNS
TVRGMGALPGDFQEPYLHYFRFDAERRFAEFAPGVLIPLAPTQGAIAAQPAGDKPTSALL
LGAYGGNLSLASLVEGTSLFVSVEVPGAKMWTGDSNAAQGDGVVNQTGIESAMEDLRIQY
VLHKRVALNAPLAETPTHWIVLGAGPTLEEALTAALRQMIGWISAATALSWHDVYALCSI
EGSFRVTQYANQTNSNYSFPSPKVIHATLPKRIFSAERQTKISRSLRPQNS
Download sequence
Identical sequences F8GYU6
gi|339323992|ref|YP_004682885.1| gi|339323992|ref|YP_004682885.1|NC_015724 WP_013954320.1.32076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]