SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339324156|ref|YP_004683049.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339324156|ref|YP_004683049.1|
Domain Number 1 Region: 96-129
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000111
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.056
Further Details:      
 
Weak hits

Sequence:  gi|339324156|ref|YP_004683049.1|
Domain Number - Region: 15-70
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00283
Family Duplicated SiR/NiR-like domains 1 and 3 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339324156|ref|YP_004683049.1|
Sequence length 409
Comment replication initiation protein RepA [Cupriavidus necator N-1]
Sequence
MKFSFDGLPIARRTTMCGGTSHAPNPVAADGRQPKAARLDAGRLPERILRAIALVYESDG
LRTLHITNRQVLATLVRFALNQKDPSALAFIKKATIAQHLGISEATVYRALGALENAGLI
ERERQRRTRAQLEVVGRIGFSAKLLRCIGIASPQFQSTVHVPARSDESRTSACLASVSGV
NKTMQSSTKKHPGSGSSLRIDGRAVPMDLAPLVRDQSLKMSALFLLMRLARTAGHRLSDV
VSAAGNALGPLRGRELFAYLKSLLERPVDYGHVVRTRKLREDDERAAEARATQERQQIAE
LVERYRGKRVSAPDGSTYEVDSASIVITDANGHRSSLAHDRARAWLIELDKVAGGLAPAV
AQPAQARQRSSVVAHAAIEDIRRLMRARQAPQYVSRRPVRPDAGVCRSA
Download sequence
Identical sequences F8GY77
WP_013954484.1.32076 gi|339324156|ref|YP_004683049.1|NC_015724 gi|339324156|ref|YP_004683049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]