SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339327050|ref|YP_004686743.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339327050|ref|YP_004686743.1|
Domain Number 1 Region: 120-287
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 410-553
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00054
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.0092
Further Details:      
 
Domain Number 4 Region: 252-276,315-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339327050|ref|YP_004686743.1|
Sequence length 560
Comment sulfite reductase beta subunit CysI [Cupriavidus necator N-1]
Sequence
MYQYDQYDQRIVAERVAQFRDQVRRRLSDELTEEEFLPLRLQNGLYMQRHAYMLRVAIPY
GLLSSKQMRKLGHIAREYDRGYGHFSTRQNIQYNWMELERVPDVLAELASVEMHAIQTSG
NCVRNITTDHFAGVAPDESVDPRVLAELLRQWSTFQPEFAFLPRKFKIAISASANDRAVV
QMHDIGIYAYKNAEGETRLRILAGGGLGRTPILGTIIKDDLPWQHMLSYVESAIRVYNRY
GRRDNKYKARIKILVKAIGADKFAQEVEEEWQHSKDGPATLTQAEFDRVAQYFTPPAYEK
LADTDASYENHLLEDKAFARWVSRNVHGHKVPGYAAVTLSTKPGVASPPGDATDAQIEAV
ADLADQFGFGELRVAHEQNLILPDVKKQDLYALWQLAKKAGLATPNIGLLTDIIACPGGD
FCSLANAKSIPIAQAIQDRFDDLDYVYDLGEISLNISGCINACGHHHVGNIGVLGVDKDG
SEWYQVTLGGAQGNQTALGKVIGPSFSAEEMPEVVSRIIDTFVANRIEDERFIETLSRIG
IAPFKERVYADKQPRERAEA
Download sequence
Identical sequences G0EV22
WP_013957832.1.32076 gi|339327050|ref|YP_004686743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]