SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339327474|ref|YP_004687167.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339327474|ref|YP_004687167.1|
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.58e-31
Family Frataxin-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339327474|ref|YP_004687167.1|
Sequence length 111
Comment protein CyaY 3 [Cupriavidus necator N-1]
Sequence
MPPLSESEFLALATQELDRIEATVEAAADAADADIEISRTGNVMELEFENGTKIIINSQA
PMQELWVAARAGGFHFRRDGERWIDTRNGGELYAALSGYVSEQAGAALTLG
Download sequence
Identical sequences G0EYP0 Q0K661 R7XGW7
gi|339327474|ref|YP_004687167.1| gi|113869389|ref|YP_727878.1| WP_010812358.1.2820 WP_010812358.1.32076 WP_010812358.1.5264 WP_010812358.1.6206 WP_010812358.1.70127 WP_010812358.1.97491 381666.H16_A3442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]