SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339327662|ref|YP_004687355.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339327662|ref|YP_004687355.1|
Domain Number 1 Region: 649-1113
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-130
Family ALDH-like 0.000000304
Further Details:      
 
Domain Number 2 Region: 262-618
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.24e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000245
Further Details:      
 
Domain Number 3 Region: 88-261
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 6.93e-65
Family N-terminal domain of bifunctional PutA protein 0.000000157
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000156
Family PutA pre-N-terminal region-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339327662|ref|YP_004687355.1|
Sequence length 1320
Comment transcriptional repressor of proline utilization PutA [Cupriavidus necator N-1]
Sequence
MATTTLGVKLDDASRDRLKRVAQSIDRTPHWLIKQAIFTYLEQIERGHLPHETGAAGSAD
ADGADGAELVHGDAPQPFLEFAQSIQPQSVLRAAITSAYRRPETDCVPVLLEQARLPLQQ
AEAAIKMAKTLATRLREQKVGTGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISGANWQSHLGQSPSLFVNAATWGLLLTGKLVATHTESGLTKALTRIIGKGG
EPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEAEGFRYSYDMLGEAAMTEADAQRY
LASYEQAIHAIGQASRGRGIYEGPGISIKLSALHPRYSRAQHERVVGELYERLKSLTLLA
RQYDIGINIDAEEADRLEISLDLLERLCFEPELAGWNGIGFVVQGYQKRCPFVIDYLIDL
ARRSRHRLMIRLVKGAYWDSEIKRGQVDGLEGYPVYTRKVYTDVSYIACARKLLSVPDAI
YPQFATHNAHTLSAIYQIAGHSYYPGQYEFQCLHGMGEPLYDQVVGATADGKFNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADDTISLDELVADPVAVVEAMHRDEGVLGL
PHPRIPSPRTLYGKSRPNSAGIDLANEHRLASLSSALLAGTSERAVAEPLLGAEVPRAAD
AITAPVLNPADHRDVVGHVTEASQADVDAALQAAVNAAPIWQATPPDVRAAALERAADLM
EAQMQSLMGIIMREAGKTFSNAIAEVREAVDFLRYYAAEVRRSFDNETHRPLGPVVCISP
WNFPLAIFTGQVAAALAAGNPVLAKPAEQTPLIAAAAVRLLREAGVPAGAVQLLPGRGET
VGAALVGDARVKGVMFTGSTEVARILQRNVAGRLDAAGRPIPLIAETGGQNAMIVDSSAL
AEQVVGDVLSSAFDSAGQRCSALRVLCLQEDVADRVLEMLKGAMQELNMANPDRLSTDVG
PVIDEEARGNIVRHVDAMRAKGRRVHQADPNAAQGASCRNGTFVPPTLIELDSIEELKRE
VFGPVLHVVRFPRAALDTMVSQINATGYGLTLGIHTRIDETISHIVSRAHVGNLYVNRNI
VGAVVGVQPFGGEGLSGTGPKAGGPLYLHRLLSVCPQDAVVRSVRASEAGGGEAATLRDE
AAAAFQAWAAAELPVVAAACERLAAASPSGLTVTLPGPTGERNTYTLLPRERVLCLATQE
ADLALQLGAVLTVGADVVWPENPVSRGLFARLPKGVQSRVRMVADWTAADIAIDAVLHHG
DSDQLRTVCEQVAVRPGPIIGVQGLAQGEPNIALDRLLIERSLSVNTAAAGGNASLMTIG
Download sequence
Identical sequences G0F038
gi|339327662|ref|YP_004687355.1| WP_013958378.1.32076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]