SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspve1|128007|e_gw1.3.1443.1 from Aspergillus versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspve1|128007|e_gw1.3.1443.1
Domain Number 1 Region: 537-863
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.89e-70
Family Glutamine synthetase catalytic domain 0.00065
Further Details:      
 
Domain Number 2 Region: 177-411
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.13e-35
Family Uronate isomerase-like 0.07
Further Details:      
 
Weak hits

Sequence:  jgi|Aspve1|128007|e_gw1.3.1443.1
Domain Number - Region: 442-536
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0209
Family Glutamine synthetase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspve1|128007|e_gw1.3.1443.1
Sequence length 865
Sequence
MASRPSLHQVIQTHPLIDNHAHNLLYKSAACNYAKYPLEQIVSEAQGIALTNASSTLSFH
RAATQLATLYECPSTDWEQLKAARDQLVQSDYDGLVRKCLQGTHTLLLDDLLTDQDIEPY
DSHDRFTASPTKRIVRIEALAAQVLSKIVSGGSIPPESSDPASFQALWESFSREFNLRIS
DAIRDPAVVGFKSVICYRTGLNVQPTEDRDTKPLLQSFARTVSQATVSTPRVEDKPMNDW
LVRQTLNLLKAAKATQPNKPLQLHTGLGDNDIDLILSNPAHLQSVIAQYPEVDFVLLHSS
YPYTREAGYLACVYPNVYLDLGEVFPMVSRDAQESIVRESLELVPTTRLLWSTDGHFFPE
TFWLANKQFRDILEKVFVDYVQNGDYTNEQAIQAAVDILFYNSNRLYCLNEQPRFSTTPA
STGPLSHTLPTDSLEAFIRSYPDVKYIWMQFIDYTSTIRQRMFPILEFAKIARKQRRIGI
CLAVFWMLQDDGIAGGSTTGQFYMQPDLSTLSPNSGLDSKSATVMTWWKTNEGEPIEGCP
RTTLLNITRKLKDEFDIQATCGFEIEVVFLKPTTDPSTGEEDFVPSITNHSWSQMTRETR
RMLPLLEDVTETLASIGIYLEQFHSESSPGQFEFILPPDSPVAAVDALIKARQVITYVAE
KHGLRATLHPRPYPSAAGTASHAHVSISPPTKEDSFLAGILHHYPAVVALTLSGDASYDR
VKAGLWAGSEWVTWGTQNREAPIRKISPGHWEVKSLDGLANMYLAMSAFLAAGYAGVKED
KPLTVKDCAYDAATLSETERKDLGITTKLPNTLAKSLEALESNKTLQGLLGPNLVNNYIM
VKRAESKKLNAMDEKARRKWLVERY
Download sequence
Identical sequences A0A1L9PGG0
jgi|Aspve1|128007|e_gw1.3.1443.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]