SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspve1|45045|fgenesh1_kg.9_#_219_#_Locus110v1rpkm1114.90 from Aspergillus versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspve1|45045|fgenesh1_kg.9_#_219_#_Locus110v1rpkm1114.90
Domain Number 1 Region: 110-355
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.75e-71
Family Glutamine synthetase catalytic domain 0.0037
Further Details:      
 
Domain Number 2 Region: 20-107
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 8.89e-21
Family Glutamine synthetase, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspve1|45045|fgenesh1_kg.9_#_219_#_Locus110v1rpkm1114.90
Sequence length 358
Sequence
MAESSTNVSNTENLMKYMSLDQKGAVMAEYIWIDSNGGTRSKTKTLSKVPTGVDELPEWN
FDGSSTAQAPGDNSDVYLRPCALYPDPFRRGDNVLVLCETWDSDGTPNKFNYRHDCNRLM
ETHAKEEFWFGLEQEYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVYCRDIVEAHYR
ACLYAGVKISGINAEVMPSQWEYQVGPCAGIEMGDHLWLSRFLLHRVAEEFGVKISFEPK
PIKGEWNGAGLHTNVSTNATRADGGMKAIESYMKKLEARHVEHIAVYGEGNEERLTGRHE
TGNIDKFSFGVADRGGSIRIPRQVAKDGKGYFEDRRPASNADPYQITGIIAETLCGGL
Download sequence
Identical sequences A0A1L9PVG8
jgi|Aspve1|45045|fgenesh1_kg.9_#_219_#_Locus110v1rpkm1114.90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]