SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspve1|55083|fgenesh1_pm.8_#_355 from Aspergillus versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspve1|55083|fgenesh1_pm.8_#_355
Domain Number 1 Region: 116-478
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.34e-88
Family Glutamine synthetase catalytic domain 0.0000484
Further Details:      
 
Domain Number 2 Region: 20-102
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0000157
Family Glutamine synthetase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspve1|55083|fgenesh1_pm.8_#_355
Sequence length 480
Sequence
MAAAITVEDLPRLLATDIAVKVAGIDCDGILRGKVMHKDKFLGIAEKGFGFSSAVFGWDM
QDVLYSNDAKIASPEEGYVDFIAVPDLSTFRRIPWEDDIPFFLVRFVQNGEEVVADGRNM
LKEISDRLEEANCQALAGVELEFMNFQTPSQDGYGQGQGQIHDLAAFLENNPPRALRPIT
SGSFSYSATRPVAFKEYFYDVFNTSCQFNCPIEGWHTEGGPGVYEAALKVSPVNEMADKT
ALFKLLAKSIGLKYGITPCFMAKPIQGQPGSSGHIHISLCSQDGKNLFARESQDPEAPWP
DVAAVSDLGRHFLGGLLEALPDIMPLFAPTINSYKRLVENYWAPINISWGLEDRTASIRI
IAPPVCKPGATRFEIRIPGADLHPHYALSAILAAGWRGVQKEVNITVPPLSAMTLDMPKP
GLLPNTLELALKRFSAKGSIAREILNDEFVDFFTATRDHELRVWREAVTDWEFKRYIETV
Download sequence
Identical sequences A0A1L9PU40
jgi|Aspve1|55083|fgenesh1_pm.8_#_355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]