SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspve1|815034|CE610104_22206 from Aspergillus versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspve1|815034|CE610104_22206
Domain Number 1 Region: 119-476
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.53e-95
Family Glutamine synthetase catalytic domain 0.0000387
Further Details:      
 
Domain Number 2 Region: 19-114
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000000445
Family Glutamine synthetase, N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspve1|815034|CE610104_22206
Sequence length 478
Sequence
MSDSKVTFENVAEVLQNDTRVKLAGVDADGMLRGKLVSKKKFLSVIDDGFGFCSVIFGWD
MHDRTYFRELQISNKENGYRDILAKPDLSSFRRIPWENNVPFFLVSFYDPDTREPLLACP
RGLLNEALRKPAAKGYRAMAGAEFEFYQFATPDRNASSTATFLKENPVETLPPLTEGMFG
YSLTRPIHNQEYYYGVFDACEQFNCGIEGWHTESGPGVYEAALQFGEASEMADKAGLFKY
VVKSIGTKHGITPTFMAKPREGLPGNSGHMHISLVNSDGTNAFFRSTPDPSPPYPDVAHL
SDVGRYFLAGILAGLPDIMPMFAPTVNSYKRLVENFWAPVTVSWGLEHRAASIRLITPPA
ASPKATRLEIRVPGADANPHFVLAAIVALGWRGVEKKLEIPVPPLSKGEDMGGANDKGVR
LAKNLGAATATFMHKDSVAREVFGDAFVEHFGGTREHEVRLWEEAVTDWEVRRYIETV
Download sequence
Identical sequences A0A1L9PTL5
jgi|Aspve1|815034|CE610104_22206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]