SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|119100|au.139_g20202 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|119100|au.139_g20202
Domain Number - Region: 27-100
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0016
Family KorB DNA-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|119100|au.139_g20202
Sequence length 108
Sequence
MAYATTVERKNKRDKFASQVSATYDVEKIEKKKKSIKKFVKLSDLPTEEQDRIINSIPNM
TNAEILAYSFPNPKKKARQQQRNRRSSMMKKQQRRERRQKIKDLRARE
Download sequence
Identical sequences L1IFX4
XP_005821769.1.50599 jgi|Guith1|119100|au.139_g20202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]