SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|122940|au.581_g24042 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|122940|au.581_g24042
Domain Number - Region: 35-79
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00916
Family KorB DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|122940|au.581_g24042
Sequence length 226
Sequence
MSEQPKTRDSVTVTPKRAGEGASAYDVQLDLTIIEPLFHMRQKDAAKFLGISLTTLKRAC
RLLGVQRWPYARLRDERAGNQALLLDLEEEGDEEEGGEEEEEEEEEEECYSEHEAGRASS
VATASSGHARRPLHERAIAPASARRGPASVWTASQGSGGAETSSAGVTSSSSRTTPRIDG
EGTSSPQSRGETPGSHTESAPEPSSQAIDAHWLEWYLSCEDEDGRE
Download sequence
Identical sequences L1I3R2
jgi|Guith1|122940|au.581_g24042 XP_005817831.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]