SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|72636|e_gw1.43.138.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|72636|e_gw1.43.138.1
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 2.79e-21
Family ParB-like nuclease domain 0.0032
Further Details:      
 
Domain Number 2 Region: 91-176
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00000000000876
Family KorB DNA-binding domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|72636|e_gw1.43.138.1
Sequence length 267
Sequence
MNYLDIDIKNLILSTLNVRKTLTSEEDETGIEDLANDIKNNGLINPITVKKIDGNKYEII
AGQRRYLAMKLLNKESISCHVLNISDQKAEEISLVENVQRNQMTTNDKVRAYSKLYEVYE
GDIERVVNAIHISKKTLQKYIKIKDLPEEVLRSLDVSGPSKISLEVAVELTKLPSSINVT
EFMTKIQQLSTQQKMDTIKVFNSLKSTDISDVDDIKEEIVINSNNIKLAPSYPYVKDEHD
RYIRIPEELYEDIIKLIELKTGTLEYI
Download sequence
Identical sequences L1J731
jgi|Guith1|72636|e_gw1.43.138.1 XP_005830889.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]