SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|93085|estExt_Genewise1.C_150206 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|93085|estExt_Genewise1.C_150206
Domain Number 1 Region: 353-674
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.2e-88
Family Phosphotransacetylase 0.000000321
Further Details:      
 
Domain Number 2 Region: 186-312
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000000000000314
Family DRTGG domain 0.043
Further Details:      
 
Domain Number 3 Region: 8-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000796
Family Nitrogenase iron protein-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|93085|estExt_Genewise1.C_150206
Sequence length 683
Sequence
MTAVEEVGLLYAVLPRAPRVGYFRPFAEGENDRSISLMRSIFRLDDSPEVMQGITVAEAT
KLLSHGQEKELFDQILSKYVEYRKGKDFVLVSCGRLENDSHFWSQKMAAALNLPVLLISD
VGHESDLAIIKGGLESSNVKIAGVLMSGLPPGNEYAETANECKEAIEQLGLRSVGMLPKS
AIIHQVTMAEVVDALGAKVFFGEESLDRSIVKDITVATLDMNRMLHRLRVHPGTLVIVHS
GRADVLLSLVLAARSSNYPRPAGILLTGSRNLDPDVDDILCGLNGIAMPVIGVEEDTFAC
TTTLLKHRPVLLPSSTTKIEAAQVLFQKHIDPKFLNQLVATNADDYVVTPKLFQHNIFSA
ARTDKQRIVLPEGDDPRVLAAAGELLARNLCEVTILGKEDLIQNKAKRNHVSLKGAKIVD
PETETTEEMVDALYNARKSKGMTKELARDMLQGEPNWFGTMMMYLDQADGMVSGACHSTA
ATMRPALQVIKMAPGFSLVSSVFFMLLPGRVLVFGDCAINVDPTADELAEIAVASAHTAR
AFGILPRVAMLSYATGDSNQGPMIDKVREATKKARLLAPNELIEGPIQFDAAVDPAVAAV
KYKGQDSPVAGKATVLVFPDLNAGNNAYKAVQQASKSIAVGPIMQGLRKPVNDLSRGCTI
DDIVNTVVVTCLQSKASKELAKK
Download sequence
Identical sequences L1JP48
jgi|Guith1|93085|estExt_Genewise1.C_150206 XP_005837331.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]