SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|134570|fgenesh2_pg.11_#_256 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|134570|fgenesh2_pg.11_#_256
Domain Number 1 Region: 238-344,423-506
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-29
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 109-223
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000439
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|134570|fgenesh2_pg.11_#_256
Sequence length 602
Sequence
MDFFTRTGSSDKKKKGEKAKSKKGSSKDQGSAEGIASFLQSLGNSISGSVGNGSIRAKSI
NKNQEASRASTKSKRGAKSKVARSGIVAKSGINAGNQFSRENVLMEYRSATLGTQLTEAL
ADDTLADVTFIVGPERKVVKGLRIVIAARNKFFKSMLYESKMEDGSLQATFELPSAHAVS
FDLMMKFIHAGGISWEPHQTVQLLEVSIDFQVEELMKKCMELVSESMTDNLSLAELTKLI
QILLRGEGFDVNLQHPKTGTSALHVASREGGVELVIDLLSRGANLNWTDIHGATAMHLAR
NAEVAQLLINAKADVFAADKGGNPPLVYSIVHKRKDVAELLLAMNCGEALFRSVQEKNDT
ISRKLNKGRVTPITEVKTSPTMEALLKVIEQEAELYPLMISPPSLIEVARAGSTWGTKSA
LARDEDVNQRDDREAAKLSLPGYTALHWAAAMGHFGVIQCLLSSDDIEINPTDTEEEDGY
TPLQLCINYRQRQWEACAALMRAHGAKERASFESDEDEDEDEEMEGASMSKTSINRGKTS
GSSAPTTAFFSRVFNNRITSAVSKIVARPSTSASKKWQSSKRQGGSRKVRSSHSSSKNSS
RK
Download sequence
Identical sequences L1JSY8
XP_005838666.1.50599 jgi|Guith1|134570|fgenesh2_pg.11_#_256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]