SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343083502|ref|YP_004772797.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343083502|ref|YP_004772797.1|
Domain Number 1 Region: 27-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.89e-94
Family Cystathionine synthase-like 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|343083502|ref|YP_004772797.1|
Sequence length 371
Comment Cys/Met metabolism pyridoxal-phosphate-dependent protein [Cyclobacterium marinum DSM 745]
Sequence
MKIETIAIHGGNVITDTLKPIIQPVTLSTTFEHQEDSMLYTRLENPNRKSLETVMSSLEG
GADAAAFASGNAAGNAVFQALPAGTHMIAPDDMYHGMKMLLQTVYNGKLEVQFIDLTDPE
NLRNAIKPTTGLLWIETPSNPLLKISDIRVLASIAKKNDLKVVCDSTFATPIYQQALELG
ADIVMHSSTKYISGHSDILGGILVTRVKDDFWQSIKNVQGLAGAVPSPMDSYLLTRSIKT
LPYRMKAHAFNAKRVADFLENHPYVEKVYYPGLASHRGFETAKSQMKGFGAMLSFLIKGN
ANESDHLIGNLKFFSNATSLGGVESLIERRSKVQVGDPGIPDQLIRMSVGIENCEDLIED
VDQAFNATFKP
Download sequence
Identical sequences G0J257
WP_014018864.1.78327 gi|343083502|ref|YP_004772797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]