SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343086557|ref|YP_004775852.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343086557|ref|YP_004775852.1|
Domain Number 1 Region: 9-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.7e-128
Family GABA-aminotransferase-like 0.000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|343086557|ref|YP_004775852.1|
Sequence length 400
Comment acetylornithine/succinyldiaminopimelateaminotran sferase [Cyclobacterium marinum DSM 745]
Sequence
MHISNEYLYEEDKKNYLPTFKRFPLAFIKGKGSRLWDADGKEYIDMLAGIAVNNLGHCHP
KVVKAVQDQAAELMHISNFFVSPPQVAVSKLLVDLTGLKHVFLTNSGAESVEGAIKIARK
YAHKRNKGGEIISMKNSFHGRTLATIATGQKKYQQGFAPIPTGFSQVAFNDINALKAALN
ENTAAVILEPIQGEGGIVPAEKEYLEEVRQLCDEQDILLIFDEIQCGIGRTGKLFAKEHF
EIQPDIMTLAKGLGGGMSVGALLCNEKVGDAIDYGDHGTTFGGNPMASAAALATLKAILE
EGLVERALEKGNWIMNTVKSWKTKHAMIKEVRGMGLMIGIVLDRPAAPFVKALLDDGIIV
NGTAETVIRLVPPLNIPDEDVNTVLEKLEKLIGSIEQNEK
Download sequence
Identical sequences G0J6C6
WP_014021906.1.78327 gi|343086557|ref|YP_004775852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]