SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343087418|ref|YP_004776713.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343087418|ref|YP_004776713.1|
Domain Number 1 Region: 5-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.76e-123
Family Cystathionine synthase-like 0.00000000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|343087418|ref|YP_004776713.1|
Sequence length 434
Comment O-acetylhomoserine/O-acetylserine sulfhydrylase [Cyclobacterium marinum DSM 745]
Sequence
MSKNYRFETLQVHGGQEVDPTTNSRAVPIYQTSSYVFNSAEHGANLFALKEFGNIYTRIM
NPTSDVFEKRMAALEGGVAAVATASGQAAQFLALNNFLSVGDNFVTSPFLYGGSYNQFKV
SFKRIGIEARFAKSDKVDDLAAEINDKTKAIYVETIGNPEFNVPDFEAIAALAKKHDIPL
VVDNTFGAGGYLCQPIKHGANIVTSSATKWIGGHGTSIGGIIVDGGNYNWGNGKFPQFSE
PSEGYHGLNFWETFGDNNPLGLPNIAFAIRARVEGLRDFGPAISPFNSFLLLQGLETLSL
RVQRTVDNALELAKWLEAHPKVKSVNYPGLTNSPYHATAKKYLTHGFGGVLSFEIEGDKE
TASNFINNLELISHLANVGDAKTLIIQPSATTHQQLSDEAQIAAGVTPSLLRISSGIEHI
EDLKADLTAAFDKI
Download sequence
Identical sequences G0J5N3
gi|343087418|ref|YP_004776713.1| WP_014022762.1.78327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]