SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343087512|ref|YP_004776807.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343087512|ref|YP_004776807.1|
Domain Number 1 Region: 12-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.01e-114
Family GABA-aminotransferase-like 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|343087512|ref|YP_004776807.1|
Sequence length 393
Comment class III aminotransferase [Cyclobacterium marinum DSM 745]
Sequence
MNNRQLFLSHLAQTTDFPLLIEIEKAEGVYMFGPNGEKYMDLISGIGVSNIGHRHPKVLE
AIHKQLDKYLHLMVYGEYVQQPQSLLAEAIVKTLPDSLDNVYLVNSGSEAIEGAIKLAKR
FNNRREIISCNDAYHGSSHGALSVGGNELFKRAYRPLLPGVRNIQYGDQEQLNHISTETS
AIILETIQGEAGIRVADKLYFKALREKCNQTGTLLILDEVQAGFGRTGKFWAFEHFGIVP
DILVCAKGMGGGMPIGAFIASKKIMEVFKENPLLGHITTFGGHPVSAAASLATIQVILKE
NLIETVEEKANLFRTLLKHPKIKEIRNKGLMMAVAFESFEILKPIIDRCIEDGVITDWFL
YCDNAMRIAPPLTITNEEIHIACESILKAIEEV
Download sequence
Identical sequences G0J7C2
WP_014022856.1.78327 gi|343087512|ref|YP_004776807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]