SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|372488477|ref|YP_005028042.1| from Dechlorosoma suillum PS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|372488477|ref|YP_005028042.1|
Domain Number 1 Region: 637-801
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00092
Further Details:      
 
Domain Number 2 Region: 3-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 3 Region: 142-311
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 4 Region: 523-645
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.52e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|372488477|ref|YP_005028042.1|
Sequence length 812
Comment NAD(P)H-dependent nitrite reductase, large subunit [Dechlorosoma suillum PS]
Sequence
MNKPKLVLVGNGMAGVRTLEELLKIAPDHYDITVFGAEPHPNYNRILLSPVLAGEMTVPE
IVLNDLQWYADNGIKLHLNKKVTKVDRVRRQVVAEDGTVESYDRLLLATGSNPFMLPIPG
NDLPGVIAYRDIADTDAMIEAARTHRHAVVIGGGLLGLEAANGLKLRGMDVTVVHVGPWL
LERQLDEVAGRMLQQSLEERGLKFLLQKNTEALIAGESGRVAAIRFKDGMQIPADLVVMA
VGIRPNTALAESSGIHCNRGIVVSDTLQTYDPKIYAVGECVSHRGIAYGLVAPLFEQAKV
CANHLAGYGIGRYQGSVTSTKLKVTGIDLFSAGDFMGGSDTEDIVLHDPAGGVYKRLVLK
DNKLVGGVLYGDTADGSWYFQLLREGKDVSQIRDHLMFGQSNLGDTGHQGHNKAAAMADS
AEVCGCNGVTKGVIVKAIKEKGLFTLDEVRKHTKASASCGSCTGLVEQILASTVGGAYQA
ASSAEKPMCGCTEHSHGAVRQAIRERHLTSIPAVIEALAWKNPNGCEKCRPALNYYLIST
FPHEAMDDPQSRFINERAHANIQKDGTYSVVPRMWGGVTTPNELRAIADVADKYQVPMVK
VTGGQRIDLLGVKKEDLPHMWADLAQAGMVSGHAYGKSIRTVKTCVGSQFCRFGTQDSTG
MGIELEKMLFDMWSPHKVKLAVSGCPRNCAESGIKDVGIIAVDSGWEIHVAGNGGIKTEA
AQFLCKVATAEEVKEYSGAFLQLYREEGFYLERTVHYVQRVGLDHVKRLVVEDEDNRKAL
HARLLDSLKDAADPWAEHQEAPARREFEPLAF
Download sequence
Identical sequences G8QGR5
WP_014236899.1.43509 gi|372488477|ref|YP_005028042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]