SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|372487174|ref|YP_005026739.1| from Dechlorosoma suillum PS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|372487174|ref|YP_005026739.1|
Domain Number 1 Region: 35-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.52e-55
Family Extended AAA-ATPase domain 0.00000022
Further Details:      
 
Domain Number 2 Region: 272-345
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-24
Family Helicase DNA-binding domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|372487174|ref|YP_005026739.1|
Sequence length 360
Comment Holliday junction DNA helicase, RuvB subunit [Dechlorosoma suillum PS]
Sequence
MIETDSFDSSFDADAGRLIGAESKSAQEEAIERALRPKRLADYVGQAKIREQLSIFIHAA
KRRSEALDHVLLFGPPGLGKTTLAHIVAAEMGVNLRQTSGPVLERAGDLAAILTNLEPHD
VLFIDEIHRLSPVVEEILYPALEDFQIDIMIGEGPAARSVKLDLPPFTLVGATTRAGMLT
NPLRDRFGIVARLEFYNAQELTHIVTRSAQLLNVAIEPEGALEIARRSRGTPRIANRLLR
RVRDYAEVKADGIITREVADAALSMLDVDHGGLDLMDRKLLSAVIDKFAGGPVGVDNLAA
AIGEARDTIEDVLEPYLIQQGYLQRTPRGRIATPAIYRHLGLEAPGTPAATPDLWSPKEQ
Download sequence
Identical sequences G8QF88
WP_014235599.1.43509 gi|372487174|ref|YP_005026739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]