SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|372487634|ref|YP_005027199.1| from Dechlorosoma suillum PS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|372487634|ref|YP_005027199.1|
Domain Number 1 Region: 15-301
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.48e-75
Family ADP-ribosylglycohydrolase 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|372487634|ref|YP_005027199.1|
Sequence length 307
Comment ADP-ribosyl-(dinitrogen reductase) hydrolase [Dechlorosoma suillum PS]
Sequence
MFLTQPRHPPAPPGSLLDRVRAAYLGFAIGDALGATVEFLTPGEIAAQYGVHEHITGGGW
LRLKPGQITDDTQMSLALGDAILEHPEWNLTCVAEHFLAWLKTKPIDVGNTCRRGIVRYM
HKGTLESPYSDGDAGNGAVMRNLPVVIATLGDDDAFARWSLEQAHLTHNHPLSDVATLTL
GCMTRALLRGEGKERARQLADALVAGHRNFRFDPYPKRATGYVVDTLQTVCHAFFSTDSF
EACLVKTVNLGGDADTNGALAAMLAGAHYGKAAIPFRWLRRLDRHARMAVEAQATGLLAL
SQRRAAP
Download sequence
Identical sequences G8QIZ0
gi|372487634|ref|YP_005027199.1| WP_014236059.1.43509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]