SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|372488757|ref|YP_005028322.1| from Dechlorosoma suillum PS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|372488757|ref|YP_005028322.1|
Domain Number 1 Region: 223-620
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.66e-122
Family Cystathionine synthase-like 0.00000000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|372488757|ref|YP_005028322.1|
Sequence length 630
Comment cysteine desulfurase-like protein, SufS subfamily [Dechlorosoma suillum PS]
Sequence
MTTPTPTSNPPEGLAGLLPAGLPNEATLARLASDFFAALPGNPGPVENPAPVGNVAPQSH
EPVIALGQRAPSLAPAASSQTGAPDSAVEVIPGAGRPGSAILGVPQAYAPALPQSASSAA
PVFAPATPYYFLGEGSAYPAHLPKENEIVVPRDDRVTAQSFGLPGAEDLKALLADNKAPR
ESKGSIPAAVPSRSSSFYFLDPVGADAAQAEPPVQPLAHPPLDVNAIRRDFPILAERVNG
KPLVWFDNAATTHKPQAVIDRLAWFYAHENSNIHRAAHELAARATDAYESARNKVARFIG
AGSANEIIFVRGATEAINLVAQSWGRQNIGAGDEIVVSILEHHANIVPWQQLAAEKGAKI
RVIPVDDDGQIRLDEYQKLLNEKTKLVAITQVSNALGTITPVKEIVDLAHRAGAKVLVDG
AQSVSHLRVNVQALDADWFVFSGHKVFAPTGIGVVYGKAAILEATQPWQGGGNMIADVTF
ERTLYQPAPNKFEAGTGNIADAVGLGTALDYVERIGLESIARYEHALLEYATHGLKTVPG
LRIIGTARDKASVASFVLEGFKTEEVGKALNQEGIAVRSGHHCAQPILRRFGLEATVRPS
LAFYNTCQEVDHLVATLKRLKGGRSTTVFG
Download sequence
Identical sequences G8QJ63
gi|372488757|ref|YP_005028322.1| WP_014237175.1.43509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]