SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357397843|ref|YP_004909768.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357397843|ref|YP_004909768.1|
Domain Number 1 Region: 339-569
Classification Level Classification E-value
Superfamily PHP domain-like 1.06e-48
Family PHP domain 0.00071
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.42e-42
Family DNA polymerase beta-like 0.0031
Further Details:      
 
Domain Number 3 Region: 3-82
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000000000000183
Family DNA polymerase beta, N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 4 Region: 45-147
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000112
Family Achaeal helicase C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357397843|ref|YP_004909768.1|
Sequence length 573
Comment PHP C-terminal domain-containing protein, partial [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MARPNEEIAGLIQEYADLLSVTGGDAFKARAYEKAARALGGHHADVSRLDVRQLREIPGV
GASIAEKVAEYFRTGHIPALDERRTRIPSGVRELIRIPTLGPKKAMALHEDLGIASVDQL
SAALDAGRLHGLKGFGPKTEENLRHGITLLRQAGGRIPLDQALQTAEDVVAALSAVPGCV
RCAYAGSLRRMRETIGDVDVLVAAEDSAPFMTAFTELPCAAEVIAHGGTKSSLRTAEGVQ
VDLRVLPPAAWGAGLQYFTGSKAHNIGLRTIAVRHGLKLSEYGLFDADSGELVVSETEEE
VYARLGLPWIPPPMREDRGEIAAALAGELPDPVTEADLRGDLHTHTDLTDGLAPLEDMVT
AAAARGYAYYAVTDHAPDLYMQQMTAEKALAQRERVRALDRRHRGMRVLHGTELNIGPDG
EVDWPDDFLAGFDLCVASIHSHFQLDRAAQTRRLIRAAENPHVDIIGHPTTRHLGRRPGI
DADLEAVYAACARTGTALEVNGQPERLDLCDEDIRAARGHGVRFAVDSDAHTPVHLPYVR
YAVGTAQRGWLTADEVVNTWPLRKLKSFLRTAG
Download sequence
Identical sequences F8K462
gi|357397843|ref|YP_004909768.1| WP_014140999.1.28582 WP_014140999.1.70206 gi|386353882|ref|YP_006052128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]