SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357400519|ref|YP_004912444.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357400519|ref|YP_004912444.1|
Domain Number 1 Region: 30-194
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000105
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 
Weak hits

Sequence:  gi|357400519|ref|YP_004912444.1|
Domain Number - Region: 498-534
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0115
Family Achaeal helicase C-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357400519|ref|YP_004912444.1|
Sequence length 713
Comment hypothetical protein SCAT_2934 [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MQNTTLCFRHPDLRGAEPALTGLGLPKAISGNFASVFSLALPGGGDRYAVKCFTRYVPDQ
NERYQAISKHLTSLPSARLSQPWNMGFDYLADEILVNGERYPILKMEWVQGQGLASWLDH
HHRDSTQVRKLADRFTALIDDLHTHGIAHGDLQHGNLLVAPDLTLRLVDYDGMYVPALAG
RHGTEDGHRNYQSPLRGGRDFGPDMDLFSGWVIHTALKAVAADPRLWADLHEPSGEYLLL
SEDDYKAPAASPRFARLLNHPDPDVAQSAQQLADLVDTPISAIPRLRTRAQSSGTGPQPS
GTGHASGTPGTGLPDWLREHVLVAESSDAAPSHPEGPGFRHRRRTRDLLALPVLLVSLAV
PVLFALGVLSIGIIATAASATAGLVFFENTRRTRPELREVRQQLKALKERKWAAQNPAAA
AAQLDKEIESFEDSERERAADADRESQRLTRQHQQRLAKIESDKQKLERDLRLQLTRLDD
ELTADIARRLALHQQRYLEGQLQNALIEDAKIPGIGQALKRALASAGIRTAADFHGVTIV
SAGGRYSNLTAYIDRTGGGRIDVKGIGPTKARALEQWREQRVVAARFRSPTKLPADQLQA
ARAESRQRKTDLQGRLRDIASQAASATQNAEQNLQQARGRLRQEAERARATARARREAFA
RRSVQIRQASDEIPVLDAALAAGVQRRRQLSAFSYLRFLTTGRPGSGAAHDVP
Download sequence
Identical sequences F8JQ32
gi|386356572|ref|YP_006054818.1| WP_014143671.1.28582 WP_014143671.1.70206 gi|357400519|ref|YP_004912444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]