SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357408460|ref|YP_004920383.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357408460|ref|YP_004920383.1|
Domain Number 1 Region: 4-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.51e-112
Family FMN-linked oxidoreductases 0.00000000181
Further Details:      
 
Domain Number 2 Region: 334-521
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.53e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000165
Further Details:      
 
Domain Number 3 Region: 470-628
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.5e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357408460|ref|YP_004920383.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MSAYPHLFTPLDLGFTTLPNRVLMGSMHVGLEEAEGGFERMAAFYAARARGGAGLIVTGG
IAPNDRGRPYPGGAKLTTGAEAEEHTRVTAAVHREGGRIALQILHFGRYAYHPDLVAPSA
LQAPISPHVPHALTDDEVEETIEDFVRTAELARLAGYDGVEIMGSEGYLINEFIAAATNH
RTDRWGGCYENRVRFPVEIVRRVRERVGPDFIVIYRLSMLDLVPGGSTLEEVVALAKEIE
AAGATIINTGIGWHEARIPTIATSVPRGAFAWVTRELMGAVSVPLVATNRINTPEKAEEL
LASGHADLISMARPMLADPDFVAKARAGRAGTINTCIGCNQACLDHTFSGRITSCLVNPR
ACHETELVLSPTRHARRVAVVGAGPAGLACAVSAAERGHHVTLYDAADAIGGQLRVAARI
PGKGEFHETLRYFRVQLEEHGVEVRLGHRVTPEAFAPGEYDDIVVATGVTPRVPEIDGIG
HPSVTGYLDVLGGRVRAGRRVAVIGAGGIGFDVAEYLTDPGDAASEDPAAYFRRWGVDPR
YRAPGGLGRPDHPAVPRAVHLLQRKPGKVGAGLGKTTGWIHRTELRHRGVTTLAGVTYRR
IDDEGLHITVDGEDHTLAVDTVVVCAGQEPDRALFDALRTAGHRVHLIGGADIAAELDAK
RAIDQGTRLAATL
Download sequence
Identical sequences F8JJ64
gi|386352543|ref|YP_006050790.1| gi|357408460|ref|YP_004920383.1| gi|357408460|ref|YP_004920383.1|NC_016113 gi|386352543|ref|YP_006050790.1|NC_017585 WP_014151542.1.28582 WP_014151542.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]