SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357399183|ref|YP_004911108.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357399183|ref|YP_004911108.1|
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.0000000000196
Family Cytidine deaminase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357399183|ref|YP_004911108.1|
Sequence length 122
Comment hypothetical protein SCAT_1581 [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MLPAMSDAASVDPEDRKIITLARSARARNGVPEGAAVRDETGRTYVAGTVALASLELSAL
RTAVAMAVASGAMSLEAAAVVSAPGPDAPAEADLAAVRDLGGPGTPVFLADPAGEIRSVT
HT
Download sequence
Identical sequences F8JP13
gi|386355232|ref|YP_006053478.1| WP_014142339.1.28582 WP_014142339.1.70206 gi|357399183|ref|YP_004911108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]