SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357401361|ref|YP_004913286.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357401361|ref|YP_004913286.1|
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.33e-39
Family Cytidine deaminase 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357401361|ref|YP_004913286.1|
Sequence length 130
Comment Deaminase; Adenyl acid deaminase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MTDVDWPALRRAARDAMTRAYAPYSGFPVGAAALADDGRTVVGCNVENAAYGVALCAECG
LVSALHASGGGRLTAFTCCDRTGAVLMPCGRCRQLLWEHGGPELLVDTASGIRPMRELLP
DAFGAEDLNR
Download sequence
Identical sequences F8K172
gi|386357420|ref|YP_006055666.1| gi|357401361|ref|YP_004913286.1| WP_014144502.1.28582 WP_014144502.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]