SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386856387|ref|YP_006260564.1| from Deinococcus gobiensis I-0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386856387|ref|YP_006260564.1|
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.5e-58
Family Nqo15-like 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386856387|ref|YP_006260564.1|
Sequence length 123
Comment NADH-quinone oxidoreductase subunit 15 [Deinococcus gobiensis I-0]
Sequence
MTHSDSALYAGWTELLGWLEAEAQARGLTYGKVADFPDYIYRMERPYDLPTTVMSAGVSS
GGQPLLVAAVSPRHADLKAVSLRLMGGSKHWHLHAGTRGLLEGKRPFTRERLGAVLDGAL
RGL
Download sequence
Identical sequences H8GRQ9
gi|386856387|ref|YP_006260564.1| WP_014684589.1.15941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]