SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386856892|ref|YP_006261069.1| from Deinococcus gobiensis I-0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386856892|ref|YP_006261069.1|
Domain Number - Region: 62-108
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0173
Family DmpA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386856892|ref|YP_006261069.1|
Sequence length 173
Comment hypothetical protein DGo_CA1684 [Deinococcus gobiensis I-0]
Sequence
MVTFALLLVSAYAYEVVQRPPALPTPPALELSERRAVKVTVYYPDTQVQNLRAVQRTVQV
TEETPTALAQAAANAWAQGPAGSGTGLLRAVPQGTAAPRVYLRGTHYFVDFPQAYTGLNY
GASGERMLLCTLTRTLLEKRGQDVTFLVNGQMTDTLGRMDLREPYTRQDCTDQ
Download sequence
Identical sequences H8GVP9
gi|386856892|ref|YP_006261069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]