SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386857334|ref|YP_006261511.1| from Deinococcus gobiensis I-0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386857334|ref|YP_006261511.1|
Domain Number 1 Region: 846-1178
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.88e-112
Family Methionine synthase SAM-binding domain 0.0000000616
Further Details:      
 
Domain Number 2 Region: 4-351
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.14e-103
Family Homocysteine S-methyltransferase 0.0000158
Further Details:      
 
Domain Number 3 Region: 308-582
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.57e-83
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0011
Further Details:      
 
Domain Number 4 Region: 691-823
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.28e-40
Family Cobalamin (vitamin B12)-binding domain 0.00000376
Further Details:      
 
Domain Number 5 Region: 602-688
Classification Level Classification E-value
Superfamily Methionine synthase domain 7.98e-28
Family Methionine synthase domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386857334|ref|YP_006261511.1|
Sequence length 1194
Comment 5-methyltetrahydrofolate--homocysteine methyltransferase [Deinococcus gobiensis I-0]
Sequence
MYRGNFDLLQLTRPDVIRQVHRDYFAAGADIASTNTFNSTTISQADYGTEALAFAMNEAG
ARLAREVADEFTARDGKPRWVAGSVGPTNRTATLSPDVERPEFRNVTYDDLVEAYTSAVR
GLMAGGADLILLETVFDTLNAKAALFACDEAFAAEGRRLPVMLSGTITDASGRTLSGQTP
EAFAVSTEHAHLFSLGLNCALGADLLRPHLRAIAANTGALVSVHPNAGLPNAFGEYDETP
EHTASVLADFAREGLVNIVGGCCGTTPEHIRAIADAMSALPPRTAPERTPYLRLSGLEAF
TLTPETNFVNVGERTNVTGSPKFAQAILAGDYDAGLKIARQQVTNGAQVVDINFDEGMLD
GEAAMVKFLNLLAGEPDISRVPLMLDSSKWEILEAGLKRVQGKAIVNSISLKDGEEKFLE
RARRLRRYGAAAVVMAFDERGQADNLQRRQEITARAYKLLTEQADFPPQDIIFDPNVLTV
ATGIEEHDRYALDFIEATRWIKANLPGALVSGGISNVSFSFRGNNHVREAMHAVFLYHAI
RAGLDMGIVNAGMLAVYADIEPELRDAVEDVILARRPDATERLLTLADQYKGIKREAAAQ
SAWREQPVAQRLTHALVQGITDHVEADAEEAYRELGSPLAVIEGPLMDGMNVVGDLFGAG
QMFLPQVVKSARVMKRAVAYLTPYMEAEQQESGGKGKVLLATVKGDVHDIGKNIVGVVLA
CNGYQVTDLGVMVPTEKVLDEAQRIGADVIGLSGLITPSLDEMVGVAREMTRRGMTQPLL
IGGATTSRAHTAVKIDPAYEGTVVHVLDASRAVTTTSDLLADEAGYRERIRGEYDALRER
HGGRQVRLISIAEARERAPQLAAPTPPAPRQPGRQVIEQPIAGLLDYIDWTPFFIAWEMK
GIYPNILTDPLRGEEARKLFADAQALLRRVVDEGLMQARGVIGLWPAHREGDDIVLEPLA
QAETLDHRTHEIAAGRERLPHRTRLHTLRQQREQGTPNVALADYVAEGADHIGAFAVAIH
GAEELARAFEAAHDDYNSILVKAVADRLAEAFAEKLHRDVRRNHWGYAPDETLDNADLIR
ERYDGIRPAPGYPAQPDHTEKRTLFALLDAGEVGLSLTDSCAMLPAAAVSGLYFAHPEAR
YFAVGRIGKDQVEDYAARKGWALEEAERWLGPLLAYDPAAAPPPAEVSVSGGAA
Download sequence
Identical sequences H8GYK6
gi|386857334|ref|YP_006261511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]