SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386858138|ref|YP_006262315.1| from Deinococcus gobiensis I-0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386858138|ref|YP_006262315.1|
Domain Number 1 Region: 147-345,494-604
Classification Level Classification E-value
Superfamily Subtilisin-like 4.45e-73
Family Subtilases 0.0000761
Further Details:      
 
Domain Number 2 Region: 400-476
Classification Level Classification E-value
Superfamily PA domain 0.000000000000235
Family PA domain 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|386858138|ref|YP_006262315.1|
Domain Number - Region: 86-120
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0723
Family Subtilase propeptides/inhibitors 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386858138|ref|YP_006262315.1|
Sequence length 898
Comment Peptidase S8, subtilisin-like protein [Deinococcus gobiensis I-0]
Sequence
MKNTLKTVSLLSLALVLGACGSGAPSTGTPSGVVAGGVNASALKATAMTGKWFVELEGDP
TAISAQSIGSQQASFRTLAAQRGITYQEVMSYRTLFNGFSVEADEAEIGRISELPGVKSV
YPVHKIPMPVTETVPMSQAAEMPDMYYARSMTGADVAQNELGLTGKGVKVGVIDTGIDVD
HPAFAGRIVSQYDFVGNAYTGANTPVPGPTQDDCAGHGTHVAGIVGGNVAATSTFRGFKG
VAPDVSFGAYRVFGCSGYTQEDVMVAALERAYSDGMQVVNLSIGSAFENWAETPSAIVGS
RMVKKGMVVVASAGNSGRNGSYSMGGVTMGDNVISVASVDNSKIELQSFALSDGSKVAYY
EGSGSPTAKIGANLTITKKASSTPATTNDGCTASGGFEANSLTGKAVLIRRGTCSFYEKA
SNAQKAGAAAVILYNNATGYLSPTVTGTPAVTIPVVFVSDMDGAKISGLIAGGVSVTFDG
GKTAISNPTGNTLSDFTSYGASAELEQKPDLAAPGGSIISTYPLSVGDQTGYAVLSGTSM
ASPHVAGAAALMLQAYPNTQAKDMRGLLMNTATLRFYRNGATITNFPDYVQRQGAGMLDI
VASYGNPVKVSPNKLSLGESATFATRNKVVVLKNTGATRQVYMARNVPAQTIGGTTLAPA
ASTAYASMTVNGQNVDTAGTEVIVPPFSEVELNVVVTPPAAAADKAQYGGMLSLGSKTGP
SLVVPYSGFKGDYQSIQVLGNEIVDGQTYDFPALYSKRNDVFYAENATVTTPPEFTFASY
AADPAKPTVLSTDRPSVLVQLSHQARRLDVDLLDANGTLIETLATQEYLGRNCTNNAAQK
SDTCDIYNEYPWDGKLANGTNAANGSYKLRVRVLKALGDASNPADTETYTSQTFTVKR
Download sequence
Identical sequences H8GVZ2
WP_014686337.1.15941 gi|386858138|ref|YP_006262315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]