SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392394777|ref|YP_006431379.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392394777|ref|YP_006431379.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily L28p-like 7.26e-25
Family Ribosomal protein L28 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392394777|ref|YP_006431379.1|
Sequence length 63
Comment 50S ribosomal protein L28 [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MANVCAICGKGVASGIQVSHSHIRTKRTWKPNLQRVHAIVNGTPTRISVCTRCLRSGKVQ
RAV
Download sequence
Identical sequences A0A098B4J7 A0A1M7TPN7 B8FS67 G9XQ17 I4ACA1 Q24U24
gi|392394777|ref|YP_006431379.1| gi|219669856|ref|YP_002460291.1| WP_005813371.1.13927 WP_005813371.1.27949 WP_005813371.1.73069 WP_005813371.1.80252 WP_005813371.1.82035 WP_005813371.1.85503 WP_005813371.1.88067 WP_005813371.1.94859 WP_005813371.1.96982 138119.DSY2679 272564.Dhaf_3839 gi|89895425|ref|YP_518912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]