SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392394852|ref|YP_006431454.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392394852|ref|YP_006431454.1|
Domain Number 1 Region: 10-168
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000602
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392394852|ref|YP_006431454.1|
Sequence length 169
Comment hypothetical protein Desde_3375 [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MAGKKGIPVLIEKEGQLMAVVSTKGDPNEVMEKAMQALFGSVYGLKFQLKKQGIEFKVGK
LIGRWPDAHLVPKDQWTGIWGLPVPQGTTELPQKSAEFPVRLEHWDYGTVAEILHIGPYT
EEGPTIQTLHTFIEESGYEIVGVHEEEYLTKPTSKVVKTVIRYPVKQKS
Download sequence
Identical sequences I4ACH6
gi|392394852|ref|YP_006431454.1| WP_014795137.1.96982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]