SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392395225|ref|YP_006431827.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392395225|ref|YP_006431827.1|
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily ITPase-like 1.96e-69
Family ITPase (Ham1) 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392395225|ref|YP_006431827.1|
Sequence length 202
Comment RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MKVLLATQNRGKVKELQDLLSGEEIEVLSLEDLDHWEEVEETGSTFAENAAMKARIAAQR
TGLVSLADDSGLEVDALQGAPGVYSARYAGEPKDDDKNNDRLLQELEGVPEEQRTGRFRC
ALVIAAPTGEEYLTEGTVEGRILNERRGKEGFGYDPLFYLPDFGRTMAQLNLSQKNKISH
RAEAFRQAVPILKEFAQRNEKA
Download sequence
Identical sequences I4ADJ9
gi|392395225|ref|YP_006431827.1| WP_014795506.1.96982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]