SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392393360|ref|YP_006429962.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392393360|ref|YP_006429962.1|
Domain Number 1 Region: 6-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.55e-64
Family G proteins 0.000037
Further Details:      
 
Domain Number 2 Region: 396-510
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.97e-27
Family Translational machinery components 0.0021
Further Details:      
 
Domain Number 3 Region: 512-594
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.51e-16
Family EF-G/eEF-2 domains III and V 0.0073
Further Details:      
 
Domain Number 4 Region: 322-397
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000863
Family EF-G/eEF-2 domains III and V 0.0033
Further Details:      
 
Domain Number 5 Region: 210-311
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000118
Family Elongation factors 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392393360|ref|YP_006429962.1|
Sequence length 882
Comment small GTP-binding protein domain-containing protein [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MKKLVIGICAHVDAGKTTLSESLLYLSGAIRKMGRVDNKDAHLDNFELERARGITIFSKQ
AMLEVGDVQITLVDTPGHVDFSLEMERTLQVLDYAILVINGADGIQGHTKTLWRLLAIYQ
IPVFLFINKMDQVGTDKEKIMNELKQQFSDGCIEFGQTEADDFYDQLAMSDEILLESYVD
RGQIEIPQIIEAVRKRKVYPCFFGSALKLEGVEGLMQGMVNYAHIPSYPEAFGAKLFKIG
RDEQGNRLTYMKITGGRLKVRDSLSNGVWEEKVNQIRIYSGKKFEAVNEVEAGSVCAVTG
LTQTKPGEGLGIEAASHAPLLEPVLAYQILLPEGCDPRVMLPKLRQLEEEDPGLHMVWDE
QLSEIQVQIMGEVQLEILQSLIQSRFGIEVSFGSGRIVYKETIGGVVEGVGHFEPLRHYA
EVHLLMEPGERGSGLQFGVECSEDVLGKSWQRLILSHLEEKVHKGVLTGAPITDMKITLV
SGRAHTKHTDGGDFREATYRAVRQGLKSAESILLEPYYSFHLELPEKMVGRAMTDLEKMH
GTCQITHIEGNIAVLTGSAPVLTMRNYHKEVMAYTKGLGRLFCSLKGYEPCHNPEEVIEK
AGYDSERDVDNPTGSVFCAHGSGFLVPWDEVKDYMHVESYFQKEHELFEEGPYVQASYSE
ERWIDPEEIDRILNQTYYANQGKKSVWQKRKTAAESYYRPTADLHKFKELKEDYLLVDGY
NIIFAWPELKELVKDNMDGARMRLLDTLSNYQGIRKCRIMVVFDAYRVQGHPEEVVDYDT
IRIVYTKEAQTADQYIERFAYDHQKKFNIAVATSDGLQQIIIRGAGCALLSAKDLKEEIE
MANESVRQAYQAKQTETRNYLKDALSAKTEQQIKELLKEEKE
Download sequence
Identical sequences I4A884
gi|392393360|ref|YP_006429962.1| WP_014793657.1.96982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]