SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392393966|ref|YP_006430568.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392393966|ref|YP_006430568.1|
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-80
Family G proteins 0.00000876
Further Details:      
 
Domain Number 2 Region: 459-575
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.09e-44
Family Translational machinery components 0.0000197
Further Details:      
 
Domain Number 3 Region: 577-666
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.97e-26
Family EF-G/eEF-2 domains III and V 0.00016
Further Details:      
 
Domain Number 4 Region: 263-377
Classification Level Classification E-value
Superfamily Translation proteins 2.18e-26
Family Elongation factors 0.00048
Further Details:      
 
Domain Number 5 Region: 382-459
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.12e-20
Family EF-G/eEF-2 domains III and V 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392393966|ref|YP_006430568.1|
Sequence length 673
Comment translation elongation factor 2 (EF-2/EF-G) [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MKTYDTMNLRNICLVGHGGAGKTSLAEACLFNSGAITRMGKVSEGNTMSDSLPEEIKHKV
SISTSLIPVEWQGYKINILDTPGYSDFFGEVKSALRVAESGVAVLCGVSGLEVQAELILD
LMEEQKLPRVIFINKLERENANFEKVLSQLIETFPNMRFAPLTLPIGHEDQFQGVVDIIE
RKAYIYENNASGKYTVKDIPSDLLADVEHYREILAEAVAEADDDILTKYLDGETLSDDDL
RQALKSALEQDLTVPVLAGSAFKNVGIGNLLDFFVQYAPVPQVKEEKSALIFKTLADPYV
GKMSFIRVYGGKLQGDSMVYNAQKEKEEKISTPFILRGKNQDPVQIVPAGDIAVVAKLQE
AATGDTLCSKDNSVHLEGIDLPVPRLPVAIAPKSKGDEDKLGSALARLVEEDPTMRVEKN
VETKELILYGMGEMHVEILMEKLQRKFGVGVEMKIPRVPYRETIKKPVKVEGKHKKQSGG
HGQYGHVWISMEPLMDGEFEFAEEVFGGAVPRQYFPAVEKGIREAMVEGVLAGYPVTGFK
VTLTDGSYHSVDSSEMAFKLASIIAFRKGAEMAKPTLLEPISEVEIRVPEAYMGDVIGDI
NGKRGRVLGMEADGKFQVIKAHVPQSEMMRYAIDLKSMTQGRGSFDIRFLKYDEVPTKIS
EGIISELKAAQGN
Download sequence
Identical sequences I4A9Z0
gi|392393966|ref|YP_006430568.1| WP_014794258.1.96982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]