SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392394131|ref|YP_006430733.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392394131|ref|YP_006430733.1|
Domain Number 1 Region: 452-560
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392394131|ref|YP_006430733.1|
Sequence length 599
Comment high affinity sulfate transporter 1 [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MNTAVFEKHFPLIDTLRTYKKEYIKKDITAALTVAVIAVPQSMAYALIAGVNPVYGLYTA
IVSTILCSLFSSSNHLIGGPTNAIALLVASSMKNHMALENAYEILFLLTFLVGALQLLFG
ILKLGKLINFVSHSVIVGFTAGAAVLIGLGQLNSFLGISIPNSSEMSTLNKLLYLVTHLE
KVNYYALGLGLLSILVIVICKRINKNLPGALLGVCLSSVLVVVFSMEQFGVKLTGTIPSQ
LPPFKMISFDFGLAGELMSGAIAIAIIALVEAISISKAIASQSRQKIDANQEIMGQGITN
VVAPFFQCFPGTGSFSRSAINFQSGAATRIAGILSGVFVAIVLLFLGSYAKYIPMASLAG
VILNIAYNMVNRAEIKRIFKLNKADALVMGTTAVAAVVLPHLDTAVYLGIAVSIMIYLRE
GSKVHIKILTPAQGKENTFIEKEIQSVEAKVDTLIVHIQGNLYFGCADELEKKLDLLVGK
ASIVIIRMKRVNSIDVTSLDTMKLFVQKIKETGGKVIISGVSSSVDKLLTESKLAQEIGE
ENIFISQEDLFASSNEALKRAKYFLDYDISKVKEMFSNSAFIFNDQFDSPRQAVSQNTN
Download sequence
Identical sequences I4AAF5
gi|392394131|ref|YP_006430733.1| WP_014794422.1.27949 WP_014794422.1.96982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]