SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CMJ172CT from Cyanidioschyzon merolae strain 10D 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CMJ172CT
Domain Number 1 Region: 354-493
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-32
Family CBS-domain pair 0.003
Further Details:      
 
Domain Number 2 Region: 507-594
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.28e-18
Family CorC/HlyC domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CMJ172CT
Sequence length 672
Comment pep:novel chromosome:ASM9120v1:Chr10:472995:475013:1 gene:CMJ172C transcript:CMJ172CT description:""
Sequence
MGAFRGWALSVSSRRSACVLAEPLAFGVALQGRRFGAHCVPRFGRRGGTVRNRQHTQPRR
RCRRNERLPKVCCLLTRNRKRCGDLPVKSAATCRTRALRLELLLRMFQRALAAAAAMATL
VFLRDLGLVLAPVWAAVSTSTLPLVASNNLVLEFPARSALAASQLPYHELRKKALAWVLL
FASSSALAAAETAITALYPWKVRDLAESEGSNSPFGRLNQDITRYLTTILVASTICGVYS
TALATEMATRIFGSVGVGYATGVMTVVFLFFGEILPKTLAVHNSEKVARFMLRPLHLLSL
LLYPVGKAFSFLVNLTLTASGLEHSSEPLVSENELRLITAGARRSGGINIHEQDMIESVL
DLEETEVREIMKPRVEMTCISCESTLEEFLALEKTTHYSRYPVFKENVDDIIGILYVKRL
LEFLGSEDGHLRNTRIGRLAEPAMFVPESLPVWRVLEEMRRKRIHMAIVVDEYGGTAGLV
TLEDIMEEIVGEIYDEDDSDYEEEGQEIVRIDENTWVMDGQARLERVAETIGMEVSEDDL
HEYGTIGGFLCDRMDGIPDPGDSAVIDAFQFSVDDADDRRILRVRARRFTAAPTQTDAPD
VEDPVQTDIASKSDRAHRMSTEQDGSASSNRSDGLSADAAGLDPGTKTNLQGNSLRKLLP
STSTRTEAQANS
Download sequence
Identical sequences M1URQ2
CMJ172CT gnl|CMER|CMJ172C XP_005534903.1.94140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]