SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CMM076CT from Cyanidioschyzon merolae strain 10D 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CMM076CT
Domain Number 1 Region: 249-532
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.14e-84
Family Cryptochrome/photolyase FAD-binding domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 7-226
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.49e-34
Family Cryptochrome/photolyase, N-terminal domain 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CMM076CT
Sequence length 1225
Comment pep:novel chromosome:ASM9120v1:Chr13:169670:173348:-1 gene:CMM076C transcript:CMM076CT description:""
Sequence
MSSSRRPSVVWYRGHDLRVEDMPALLAAVQRGGPVVPVFIWAPEEDGMWCLGRPARWWLS
RSIVALDRRLRELGCETGLILRRAKSESGGGGGVETTLLEVVKRCGAEAVYWNRVYDPVV
LRRDEEVRRRWSKHHRLAVESFKAELLVEPWEVCATESRPASFGDRPLDTFHEFMSAWMA
MPPPPEPLPAPKRIEPLIASQSGDQGPLFAVPESTMQPSDVLQSPGGEDTDTEMGIWWNQ
IHNLGSLEEYWRPGVDCVAERLQDFLTSVFPTYGDARRRQRLRNGTSRLSPYLRFGELSP
RRLYHAVRASVLQSEPSDAIIRAARTLLRNLCLREYAYHMLFYRPSILDRPLVPEFDHFP
CTKEDVGRLLEVWLSGRTGYPLVDAAMRELHHTGWLHSNLRFLVASFFTKYLLLPWQIGA
RCLFKLFIDGDLASNAICWQWVTGCNYDVFPLNCLVNPVVMGMRVDPEGEYVRTWCPELQ
QIPSSYIHAVWKCPPTILHQARVELGVTYPRPVVENRVARRRARDALRYLRQVVLNKRGY
GVRVPNTLSLKGTQELMSDWPIDEVYNVLDSKQEDLFGLSDLGHELPSGRQPERPMRDSD
ASIDDQEIAGDSIGGDHVGLLPRVWSMSQDDPLHNVFDLGGSASGANGAQLAGPSPGLGG
SNGYAQGPGGGNGGSSLMYGVSAGTFGNQQMALVSSGMGMGSSGVGGGGGGGGGGSDRSI
PEVVVGAPSSVDEDSYTEKLHRVDSFHALLSAGATTPLARGSIMEPTGRVPGTNPDFMRA
PPTEHLSSLSGIVAPNASHPSSAVHVSTSGSRSLVTAGGAAAALSPGQMMRTPNAAVDPG
TTSASPLLLHHTGGAGHGRGSSRGTATLPGSQSQPMGTRSMLNANLPGSVFAFESGEPGA
MPRPAPGHSLGPETSVSAPASWALINERPSLSAAEDASVHRRPGAMPASTSTRYDNGEAA
RYLEDRAGRKRALADEGVCTNPDLTMPERFPAVAAARVTQRLEHDTAGSVSSAAKTKRRA
SGAAAAPQAPAQQRTRDGSAPNEAPAPGSSALHHDATRAPAGSRWLEQGASGESLDVRSS
SASSDRTAPITLEGLGDVEPPQTRSERLELLERIHRSDNAYARFAGFLLQHYDITENVRR
NPKSTDFVRLRNLKDHFNRYSAPPRAGQGAAHREPLRIYRIKQFFSKILNLEVTGEWDRH
AHGGVRGPYVYGLVLRADALQRAAP
Download sequence
Identical sequences M1VDQ4
CMM076CT XP_005536993.1.94140 gnl|CMER|CMM076C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]