SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CMT047CT from Cyanidioschyzon merolae strain 10D 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CMT047CT
Domain Number 1 Region: 90-420
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.93e-61
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CMT047CT
Sequence length 425
Comment pep:novel chromosome:ASM9120v1:Chr20:125540:126818:-1 gene:CMT047C transcript:CMT047CT description:""
Sequence
MTSRGARTKQRLQYDDPDAVAKAEKRAVLKRAPAQRLVPLFAHLPQLEPLRPDATQVSFV
ETSGLHPRVVRLGQQLAHGVVQGGSARVVALLLALREMIADFEPTNSSSTLPPATDAAAS
MPVKVSDSGTESITETRRELERALNRHIQFLVDSRPLSIAMGNAVRFVKSRLGIQALAQS
FLELQQQIINDIDAFIEERVVLALETIFDAGADRIRDGDVVMTYDASFLVESILLRAVQK
HKRRFRVIVLDARPRHRGCALVHRLLQGGVAQCTYGLLQGAPMLVQEANLLLLGAEACFS
NGAVLAAAGTASVASLAKQERIPVAVACESLKFSERVLIDSICLNELGNPDELTWGTWMR
PNASQVGQNGGIQPPLGEDWRERYPNLKLLHLYYDVTPAEAVDALITEFGLIPPHGVAAV
TLDMG
Download sequence
Identical sequences M1VHY2
gnl|CMER|CMT047C XP_005539108.1.94140 CMT047CT

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]