SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223469|ref|YP_007107566.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223469|ref|YP_007107566.1|
Domain Number 1 Region: 253-416
Classification Level Classification E-value
Superfamily CinA-like 1.22e-53
Family CinA-like 0.000047
Further Details:      
 
Domain Number 2 Region: 3-207
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 2.09e-40
Family MoeA central domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223469|ref|YP_007107566.1|
Sequence length 423
Comment competence/damage-inducible protein cinA [Geitlerinema sp. PCC 7407]
Sequence
MNVSAEVICVGTELLLGSILNTNAQFLAQQLAEIGVPHYYQTVVGDNPERLKKVLAIACE
RSRLLIFTGGLGPTPDDLTTKTLADFFEAPLVEHPEVLADIEQKYARRGRTMTDSNRKQA
LLPEGSAVLPNPSGTAPGMIWQPRTGLTILTFPGVPQELQMMWRETALPYLRSQGWGREI
LYSRMLRFWGVAESALAEKVAPFLTAANPTVAPYAGKGEVRLRVSAWADSEAAALQLIEP
VEHQLRQIAGLDYYGRDDDTLAAVVGRLLQGHQHTLGVAESCTGGGLGAMLTQVPGSSAY
FMGGLISYDNQAKVNLLGVNGEDLETHGAVSEAIAQQMAVGARSRLGTTWGLSITGIAGP
GGGTVQKPVGLVYIGLAGPDGFVTSVEHRFGELRGRDWIRQVSASAALDLLRRKLLALSQ
SSD
Download sequence
Identical sequences K9S413
WP_015170082.1.54702 gi|428223469|ref|YP_007107566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]