SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223525|ref|YP_007107622.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223525|ref|YP_007107622.1|
Domain Number 1 Region: 251-502
Classification Level Classification E-value
Superfamily HemD-like 1.96e-73
Family HemD-like 0.0021
Further Details:      
 
Domain Number 2 Region: 3-236
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.79e-67
Family Tetrapyrrole methylase 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428223525|ref|YP_007107622.1|
Sequence length 505
Comment uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase [Geitlerinema sp. PCC 7407]
Sequence
MTTQGFVYLVGAGPGDRAYLTVRGLQILGLAEVLIYDALADPRLLDPVPETCLRLEVGKR
GGEASTPQADINALLVKHCREGRRVVRLKSGDPFIFGRSSAEIQALVAAQCPFEVVPGVS
SALAAPLLDGIPLTDPAMSQCFAVCTAHEPDRLNWAALAELDTVVFLMGGRSLAEIVHQL
VRHGRSPRTPIAIIRWAGRPQQHTWVGTLGDIVEKTQGEKLSPTVIVVGEVVQLREFLRS
PISVPQPLSNQTILVTRAAGQSSAFTQQLQAVGASVIEMPALEIRPPSSWAPLDQAIAHL
RDFDWLILTSSNGVDYFFDRMVSLGRDVRQLTGIKLAVVGKKTAASLQQRGLVPDFVPPD
FVADSMVEHFPEPPKGQRILFPRVESGGREVLVQSLGAAGAEVVEVAAYESGCPQTVDAA
ALHALQNGEIDVVTFASSKTVKHFCQLLEQAVGESWPTLVQSVAIASIGPQTSRACESAL
GRVDIEAQEYTLEGLTAAIAAWAAP
Download sequence
Identical sequences K9S325
gi|428223525|ref|YP_007107622.1| WP_015170138.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]