SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223671|ref|YP_007107768.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223671|ref|YP_007107768.1|
Domain Number 1 Region: 113-462
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.02e-97
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000717
Further Details:      
 
Domain Number 2 Region: 463-585
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.03e-33
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0005
Further Details:      
 
Domain Number 3 Region: 8-103
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 2.49e-23
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223671|ref|YP_007107768.1|
Sequence length 585
Comment arginyl-tRNA synthetase [Geitlerinema sp. PCC 7407]
Sequence
MNSTLDQLKARFSQALVKAFGEQYGEADPMLVPASNPKFGDFQSNAALALTKQLKQAPQA
IAQQIIQNLEIDDYCETPEIAGPGFINLRLKQEYLVSRLHRMLASDRLGVEPVKRPQRVI
VDFSSPNIAKEMHVGHLRTTIIGDAIARVLEFQGHDVLRLNHVGDWGTQFGMLITHLREA
CPAALQDSDAIDLGDLVAFYREAKQRFDEDEDFKERSRKAVVELQSGDPEARKAWQILCD
QSRREFQKIYDRLDITLTERGESFYNPLLADVVKDLATTGLLVEDQGAQCVFLDGFTNKD
GDPLPLIIQKSDGGYNYATTDLAAIRYRIQQDGAERIIYVVDAGQSNHFAQVFQVARRAG
WVPETVEPIHVPFGVVRGEDGKKFKTRSGETVRLKDLLDEAVTRARTDLSTRVQEEGRDE
SPEFIGHVAETVGISAVKYADLSQNRTSDYVFSYDKMLALQGNTAPYMLYAYVRIQGISR
KGQIDFTQIANDVPIDLQDESELTLAKHLLQLDQILAAVSVELLPNRLCQYLFELSQKFN
QFYDRCPVLQADEPQRTSRLALCDLTARTLKLGLSLLGIPVLERM
Download sequence
Identical sequences K9S427
WP_015170284.1.54702 gi|428223671|ref|YP_007107768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]