SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223718|ref|YP_007107815.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223718|ref|YP_007107815.1|
Domain Number 1 Region: 87-514
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.51e-115
Family Amylase, catalytic domain 0.00000000288
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily E set domains 7.8e-17
Family E-set domains of sugar-utilizing enzymes 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223718|ref|YP_007107815.1|
Sequence length 608
Comment maltooligosyl trehalose hydrolase [Geitlerinema sp. PCC 7407]
Sequence
MRVGAAYLGSDRCEFTVWAPDKQSVSLEILAPEPQTIPLTKGDRGYWRAVVTTPPDTRYG
YRIDGGELRPDPASHFQPEDVHGSSAVVDHSAYRWGDRDWQGLPLADYVIYELHVGTFSS
EGTFEAIVPRLADLKALGMTAIELMPVAQFPGDRNWGYDGVYPYAVQTSYGGPEGLKKLV
DACHQAGLAVVLDVVYNHFGPEGNYTAEFGPYFTEQYRTPWGSAINFDHAHSDGVRNFFI
QNALHWLRDYHIDALRLDAIHAIYDFGAKHFLQELAEATALLSQAEGRPRYLIAESDLND
VRVIRPRDLGGYGLDAQWSDDFHHALRTVLTDEKTGYYADFGRCEQLATAMEESFVYSWR
YSPFRQRYHGSDARDRPPVQFVVSSRNHDQIGNRMLGERLSVLTSFDGLKLAAATVLLSP
YIPLLFMGEEYGEEAPFLYFISHTDADLVEAVRQGRREEFADFHAEGEAPDPFSRETFER
STLNWELRQSGKHQVLLSFYQALLALRRSRPALRTLTRQNLQAIGHDDSKLLILQRSAAE
NHLWAAFNYSLQPQTVGDRPPQGTWEKILDSAEPQWQGAGATAPEKLTPAGETLTLPAQS
LVLYERRF
Download sequence
Identical sequences K9S3L5
WP_015170331.1.54702 gi|428223718|ref|YP_007107815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]