SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223763|ref|YP_007107860.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223763|ref|YP_007107860.1|
Domain Number 1 Region: 11-431
Classification Level Classification E-value
Superfamily Clc chloride channel 6.15e-104
Family Clc chloride channel 0.00000229
Further Details:      
 
Domain Number 2 Region: 441-569
Classification Level Classification E-value
Superfamily CBS-domain pair 5.94e-35
Family CBS-domain pair 0.001
Further Details:      
 
Domain Number 3 Region: 592-723
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.93e-21
Family Universal stress protein-like 0.01
Further Details:      
 
Domain Number 4 Region: 758-884
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000000544
Family Universal stress protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428223763|ref|YP_007107860.1|
Sequence length 897
Comment Cl- channel voltage-gated family protein [Geitlerinema sp. PCC 7407]
Sequence
MRYPPVLQFVRPLLRPKRTAILEACLIGLVAAFAVVILRQGIGLLGGWRVHLAQQGPAWL
VLSGIGAVGGFLAGWLVERVAPETAGSGIPQVKAVLARVPIPLDLRVAAVKLLGAVLALG
SGLTLGREGPTIQMGAAIGAQLSRWFPTSPDHRRQLIAAGAGAGLAASFNAPLAGVLFVV
EELLRDVSGFTLGTAILASFIGSVVARLLGGRGLDVNLAAVPVQANFHAVDIPFYLLLGL
LAGVLGPLFCRGILASLTINRRVLKLSMPWRMALAGCLSGLVVSVLPLPFRDHAGLRASL
VTGAADWQTMAIAFGAHAVLTMLAYGSGAPGGLFAPILVLGSALGYMVGAGEQQLLGVGL
PTTYALVGMGAFFSAVSHVPITSVVIIFEMTTDFNLVLPLMVGSVVAYFVADKVDSASLY
DHLLAWNGIELERSPSAEPEWANLRAADVMQRRVETLASQLSVEEAMQAFSRSHHRGFPV
VDDGKLVGIITQSDLAQAAARSATVLRDLMTPQPVTVSPDDTLNQVLYLLNRYKLSRLPV
TEGRRLVGIITRADIIRVEADRLTGESDRPGPQTAPSYCVYQTRSPTVGQGRLLVPLGNP
QTADLLLQMAVAIARDRHYEIECLRVIQISRHQLPTETSVDTLESRRLLQRAVRLGRDLH
IPVHTQIRVAHDPAQAVLETIEERHINLICMGWKGSTTTPGRVFGSTMDTVIRQAACDVM
LVKFGAGVALAPRSPIFAEAHRLPFGGEKARAAASLQNFDRWLLPIAGGPNAQRALHFLP
GLIALSSHPKVRLYQVFTSLQAPMSSDLLVQDVEFLSQHLNCPVVATTAQDSSVAESIQD
LALRDQTDVIVLGATREGLLQQVMQGNIPEAIARKSPCTVILVRGAIADEPPSAWGV
Download sequence
Identical sequences K9S3Q0
WP_015170376.1.54702 gi|428223763|ref|YP_007107860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]