SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223767|ref|YP_007107864.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223767|ref|YP_007107864.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 1.7e-37
Family Ribosomal protein L21p 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223767|ref|YP_007107864.1|
Sequence length 117
Comment 50S ribosomal protein L21 [Geitlerinema sp. PCC 7407]
Sequence
MTYAIIETGGTQLRVEPGRFYDVNRLAVDANGTLTLDRVLLVQNDGEVTIGQPFVEGATI
EATVLSHLRGKKIIVYKMRPKKKTRKKQGHRQELTRIMIDAISLNGTKLTAAEKAEA
Download sequence
Identical sequences K9S2K0
WP_015170380.1.54702 gi|428223767|ref|YP_007107864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]