SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223891|ref|YP_007107988.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428223891|ref|YP_007107988.1|
Domain Number - Region: 150-197
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.00824
Family F420 dependent oxidoreductases 0.036
Further Details:      
 
Domain Number - Region: 161-288
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0837
Family Clc chloride channel 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223891|ref|YP_007107988.1|
Sequence length 300
Comment cell division protein FtsX [Geitlerinema sp. PCC 7407]
Sequence
MLQRLTKLNYLMQETLLGLRRGGWMNWAAISTVTVLLFLFGVNLQASWQLERLLNQFGSQ
LEVSVYLQEAAEPTAIQASVAALPEVASVAIVPREEAWASLVKDLGVADIAAATDQLNGN
PLVDELRVQVREAEAVASLAQRLEKLPGVDTVQYLAEAVQRLEQLNRGFRWLSVSVTTLL
TLTAIAVITTTIRLIVMARRREIEVMQLVGATTGWIYFPFILQGLAFGVAGAAIAWGLLG
AVQQFLRSLLTQQADFIQFLAQGLALTAAEQTLLTLILLGFGGSVGLLGSLLAVRRFAVR
Download sequence
Identical sequences K9S4Q9
gi|428223891|ref|YP_007107988.1| WP_015170504.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]