SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223947|ref|YP_007108044.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428223947|ref|YP_007108044.1|
Domain Number - Region: 18-41
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0145
Family Ribosomal protein S27a 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223947|ref|YP_007108044.1|
Sequence length 92
Comment hypothetical protein GEI7407_0492 [Geitlerinema sp. PCC 7407]
Sequence
MPRLSNSQVHYAVVVEPEMFCDHCGHGLDAESRYCSHCGHAVTPETRPEKSSRLDPATLL
AAIALGLLLLMALTGPEAFSPEPAPISAPLVP
Download sequence
Identical sequences K9S302
WP_015170560.1.54702 gi|428223947|ref|YP_007108044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]